Recombinant ZHX2 Antibody

Catalog number RN-036-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-036-01

Size / count 50 μL

Specifications

Catalog number: RN-036-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Zinc fingers and homeoboxes protein 2, Alpha-fetoprotein regulator 1, AFP regulator 1, Regulator of AFP, Zinc finger and homeodomain protein 2
Gene Name: ZHX2
Gene ID: 22882
UniProt: Q9Y6X8
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ZHX2
Target: PP-1047
Partner Proteins: Zinc fingers and homeoboxes protein 2; Alpha-fetoprotein regulator 1; AFP regulator 1; Regulator of AFP; Zinc finger and homeodomain protein 2
Clone: K94050_5A8
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 86%, Rat - 85%, Pig - 90%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: QDVPEEVDRAKEKGIGTPQPDVAKDSWAAELENSSKENEVIEVKSMGESQSKKLQGGYECKYCPYSTQNLNEFTEHVDMQHPNVILNPLYVCAECNFTTKKYDSLSDHNSKFHPGEANFKLKLIKRNNQTVLEQSIETTNHVVSITTSGP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 86%
Recombinant Antibody: Yes
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AFR1; KIAA0854; RAF
Target Alternative Name: ZHX2
Panel Description: DNA binding & Chromatin, Transcription Factors
Host or Source: Mouse
Protein Name: Zinc fingers and homeoboxes 2
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ZHX2 Antibody?

The catalog number for Recombinant ZHX2 Antibody is RN-036.

What sizes are available for Recombinant ZHX2 Antibody?

Recombinant ZHX2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ZHX2 Antibody come in?

Recombinant ZHX2 Antibody is available in 3 different pack sizes.

Is Recombinant ZHX2 Antibody in stock?

Recombinant ZHX2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

All Products