Recombinant TEX11 Antibody — image 1 of 2

Product details

Recombinant TEX11 Antibody

Catalog number RN-021-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-021-01

Size / count 50 μL

Specifications

Catalog number: RN-021-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Testis-expressed protein 11, Protein ZIP4 homolog, ZIP4H
Gene Name: TEX11
Gene ID: 56159
UniProt: Q8IYF3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TEX11
Target: PP-9358
Partner Proteins: Testis-expressed protein 11; Protein ZIP4 homolog; ZIP4H
Clone: K94052_6F11
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP
Validation: Top_IHC&Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 53%, Pig - 49%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: LQAIITLENILTDEESEDNDLVAERGSPTMLLSLAAQFALENGQQIVAEKALEYLAQHSEDQEQVLTAVKCLLRFLLPKIAEMPESEDKKKEMDRLLTCLNRAFVKLSQP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 53%
Recombinant Antibody: Yes
IHC Dilution: 1:250~1:500
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ZIP4
Target Alternative Name: TEX11
Host or Source: Mouse
Protein Name: Testis expressed 11
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant TEX11 Antibody?

The catalog number for Recombinant TEX11 Antibody is RN-021.

What sizes are available for Recombinant TEX11 Antibody?

Recombinant TEX11 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant TEX11 Antibody come in?

Recombinant TEX11 Antibody is available in 3 different pack sizes.

Is Recombinant TEX11 Antibody in stock?

Recombinant TEX11 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.