Recombinant ST3GAL1 Antibody — image 1 of 2

Product details

Recombinant ST3GAL1 Antibody

Catalog number RN-039-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-039-01

Size / count 50 μL

Specifications

Catalog number: RN-039-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2, 3-sialyltransferase 1, Alpha 2, 3-ST 1, Beta-galactoside alpha-2, 3-sialyltransferase 1, Gal-NAc6S, Gal-beta-1, 3-GalNAc-alpha-2, 3-sialyltransferase, Monosialoganglioside sialyltransferase, SIATFL, ST3Gal I, ST3GalI, ST3GalA.1, ST3O, Sialyltransferase 4A, SIAT4-A
Gene Name: ST3GAL1
Gene ID: 6482
UniProt: Q11201
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ST3GAL1
Target: PP-1287
Partner Proteins: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2; 3-sialyltransferase 1; Alpha 2; 3-ST 1; Beta-galactoside alpha-2; 3-sialyltransferase 1; Gal-NAc6S; Gal-beta-1; 3-GalNAc-alpha-2; 3-sialyltransferase; Monosialoganglioside sialyltransferase; SIATFL; ST3Gal I; ST3GalI; ST3GalA.1; ST3O; Sialyltransferase 4A; SIAT4-A
Clone: K94059_11C7
Conjugation: Unconjugated
Applications: Top_IP/ChIP&Top_WB
Validation: Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 56%, Pig - 86%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: NNLNDTIKELFRVVPGNVDPMLEKRSVGCRRCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEAD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Yes
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: SIAT4; SIAT4A
Target Alternative Name: ST3GAL1
Host or Source: Mouse
Protein Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 1
WB Description: Succeed
IHC description: Fail (Liver)
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ST3GAL1 Antibody?

The catalog number for Recombinant ST3GAL1 Antibody is RN-039.

What sizes are available for Recombinant ST3GAL1 Antibody?

Recombinant ST3GAL1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ST3GAL1 Antibody come in?

Recombinant ST3GAL1 Antibody is available in 3 different pack sizes.

Is Recombinant ST3GAL1 Antibody in stock?

Recombinant ST3GAL1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.