Recombinant TSGA10IP Antibody

Catalog number RN-023-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-023-01

Size / count 50 μL

Specifications

Catalog number: RN-023-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Testis-specific protein 10-interacting protein, Tsga10-interacting protein
Gene Name: TSGA10IP
Gene ID: 254187
UniProt: Q3SY00
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human TSGA10IP
Target: PP-9969
Partner Proteins: Testis-specific protein 10-interacting protein; Tsga10-interacting protein
Clone: K1E060_4H6
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Rat - 42%, Pig - 52%, Cynomolgus monkey - 86%
Purity: ≥85%
Cores: CWKTEAQNLKARQQLGAWGGVSIPTGKGELGSEPPSGLQLPGRRPGSGSASDKQVQLQSLGAEEAERGLSSGVLPQRPRRGSISEEEQFSEATEEAEEGEHRTPCRRRAGCQRKGQISGEEASDEGEVQGQSQGSSPSFNNLRRRQWRKT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: TSGA10IP
Host or Source: Mouse
Protein Name: Testis specific 10 interacting protein
WB Description: Succeed
IHC description: Fail (Testis)
IP description: Fail (NIH/3T3)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant TSGA10IP Antibody?

The catalog number for Recombinant TSGA10IP Antibody is RN-023.

What sizes are available for Recombinant TSGA10IP Antibody?

Recombinant TSGA10IP Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant TSGA10IP Antibody come in?

Recombinant TSGA10IP Antibody is available in 3 different pack sizes.

Is Recombinant TSGA10IP Antibody in stock?

Recombinant TSGA10IP Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

All Products