Recombinant NXPH3 Antibody

Catalog number RN-030-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-030-01

Size / count 50 μL

Specifications

Catalog number: RN-030-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Neurexophilin-3
Gene Name: NXPH3
Gene ID: 11248
UniProt: O95157
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NXPH3
Target: PP-1474
Partner Proteins: Neurexophilin-3
Clone: K94060_8A12
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 91%, Pig - 88%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: EDPERDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPNRPNHSPPPSAKVKKIFGWGDFYSNIK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: KIAA1159; NPH3
Target Alternative Name: NXPH3
Host or Source: Mouse
Protein Name: Neurexophilin 3
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant NXPH3 Antibody?

The catalog number for Recombinant NXPH3 Antibody is RN-030.

What sizes are available for Recombinant NXPH3 Antibody?

Recombinant NXPH3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant NXPH3 Antibody come in?

Recombinant NXPH3 Antibody is available in 3 different pack sizes.

Is Recombinant NXPH3 Antibody in stock?

Recombinant NXPH3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

All Products