Recombinant NTHL1 Antibody

Catalog number RN-010-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-010-01

Size / count 50 μL

Specifications

Catalog number: RN-010-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Endonuclease III-like protein 1, hNTH1, Bifunctional DNA N-glycosylase/DNA- (apurinic or apyrimidinic site) lyase, DNA glycosylase/AP lyase
Gene Name: NTHL1
Gene ID: 4913
UniProt: P78549
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NTHL1
Target: PP-3240
Partner Proteins: Endonuclease III-like protein 1; hNTH1; Bifunctional DNA N-glycosylase/DNA- (apurinic or apyrimidinic site) lyase; DNA glycosylase/AP lyase
Clone: K29067_15H5
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 72%, Pig - 70%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: SHSPVKRPRKAQRLRVAYEGSDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 72%
Recombinant Antibody: Yes
IHC Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NTH1; OCTS3
Target Alternative Name: NTHL1
Host or Source: Mouse
Protein Name: Nth like DNA glycosylase 1
IHC description: Succeed
IP description: Fail (HEK-293)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant NTHL1 Antibody?

The catalog number for Recombinant NTHL1 Antibody is RN-010.

What sizes are available for Recombinant NTHL1 Antibody?

Recombinant NTHL1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant NTHL1 Antibody come in?

Recombinant NTHL1 Antibody is available in 3 different pack sizes.

Is Recombinant NTHL1 Antibody in stock?

Recombinant NTHL1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

All Products