Recombinant PDCD6 Antibody

Catalog number RN-015-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-015-01

Size / count 50 μL

Specifications

Catalog number: RN-015-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Programmed cell death protein 6, Apoptosis-linked gene 2 protein homolog, ALG-2
Gene Name: PDCD6
Gene ID: 10016
UniProt: O75340
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PDCD6
Target: PP-1622
Partner Proteins: Programmed cell death protein 6; Apoptosis-linked gene 2 protein homolog; ALG-2
Clone: K92068_2D10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 98%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: GAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ALG2
Target Alternative Name: PDCD6
Host or Source: Mouse
Protein Name: Programmed cell death 6
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant PDCD6 Antibody?

The catalog number for Recombinant PDCD6 Antibody is RN-015.

What sizes are available for Recombinant PDCD6 Antibody?

Recombinant PDCD6 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PDCD6 Antibody come in?

Recombinant PDCD6 Antibody is available in 3 different pack sizes.

Is Recombinant PDCD6 Antibody in stock?

Recombinant PDCD6 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.