Recombinant KIAA1755 Antibody

Catalog number RN-026-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-026-01

Size / count 50 μL

Specifications

Catalog number: RN-026-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Uncharacterized protein KIAA1755
Gene Name: KIAA1755
Gene ID: 85449
UniProt: Q5JYT7
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human KIAA1755
Target: PP-9469
Partner Proteins: Uncharacterized protein KIAA1755
Clone: K52071_6D12
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 48%, Pig - 60%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: SREAGTSSGCTSGALEEIAGTKETPLFQKILPLSEANEGPSLGNRACTKPESSEERPYNLGFRRKVNLKAPTHNSERPPQGSYMNVLEDALDCASGLRAGVSQEPAASKMQGPLGNPENMVQLRPGPRQASSPRLSPASPAAAASETKIEVKTKERNGRL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 48%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: KIAA1755
Host or Source: Mouse
Protein Name: KIAA1755
WB Description: Fail (HEK-293)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant KIAA1755 Antibody?

The catalog number for Recombinant KIAA1755 Antibody is RN-026.

What sizes are available for Recombinant KIAA1755 Antibody?

Recombinant KIAA1755 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant KIAA1755 Antibody come in?

Recombinant KIAA1755 Antibody is available in 3 different pack sizes.

Is Recombinant KIAA1755 Antibody in stock?

Recombinant KIAA1755 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products