Recombinant ANKRD26P1 Antibody

Catalog number RN-011-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-011-01

Size / count 50 μL

Specifications

Catalog number: RN-011-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative ankyrin repeat domain-containing protein 26-like protein
Gene Name: ANKRD26P1
Gene ID: 124149
UniProt: Q6NSI1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANKRD26P1
Target: PP-9868
Partner Proteins: Putative ankyrin repeat domain-containing protein 26-like protein
Clone: K40073_16B3
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 39%, Pig - 46%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: HHANIESANKDELTPFLLAVHEQKQQMEDFLRKQKENLTAVKLESIHQVMSEYKENETPRNPQNSNPEGTSNKMACLGEGAAGAKVDEIPGNPVKRLFNKPSIDDSRPMSANEDFDFDTEEKATEPANGK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 39%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ANKRD26P1
Host or Source: Mouse
Protein Name: Ankyrin repeat domain 26 pseudogene 1
IHC description: Succeed
IP description: Fail (HeLa)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ANKRD26P1 Antibody?

The catalog number for Recombinant ANKRD26P1 Antibody is RN-011.

What sizes are available for Recombinant ANKRD26P1 Antibody?

Recombinant ANKRD26P1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ANKRD26P1 Antibody come in?

Recombinant ANKRD26P1 Antibody is available in 3 different pack sizes.

Is Recombinant ANKRD26P1 Antibody in stock?

Recombinant ANKRD26P1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

All Products