Recombinant ANKRD20A12P Antibody

Catalog number RN-027-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-027-01

Size / count 50 μL

Specifications

Catalog number: RN-027-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Putative ankyrin repeat domain-containing protein 20A12 pseudogene
Gene Name: ANKRD20A12P
Gene ID: 100874392
UniProt: Q8NF67
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANKRD20A12P
Target: PP-9864
Partner Proteins: Putative ankyrin repeat domain-containing protein 20A12 pseudogene
Clone: K16310_8A11
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 50%, Pig - 55%, Cynomolgus monkey - 77%
Purity: ≥85%
Cores: NQVFQQKLLSMKKVQQECEKLEEDKKMLEEEILNLKTHMENSMVELSKLQEYKSELDERAMQAVEKLEEIHLQEQAQYKKQLEQLNKDII
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 50%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ANKRD20A12P
Host or Source: Mouse
Protein Name: Ankyrin repeat domain 20 family member A12, pseudogene
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ANKRD20A12P Antibody?

The catalog number for Recombinant ANKRD20A12P Antibody is RN-027.

What sizes are available for Recombinant ANKRD20A12P Antibody?

Recombinant ANKRD20A12P Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ANKRD20A12P Antibody come in?

Recombinant ANKRD20A12P Antibody is available in 3 different pack sizes.

Is Recombinant ANKRD20A12P Antibody in stock?

Recombinant ANKRD20A12P Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

All Products