Recombinant NDUFS4 Antibody

Catalog number RN-037-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-037-01

Size / count 50 μL

Specifications

Catalog number: RN-037-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial, Complex I-18 kDa, CI-18 kDa, Complex I-AQDQ, CI-AQDQ, NADH-ubiquinone oxidoreductase 18 kDa subunit
Gene Name: NDUFS4
Gene ID: 4724
UniProt: O43181
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human NDUFS4
Target: PP-5834
Partner Proteins: NADH dehydrogenase [ubiquinone] iron-sulfur protein 4; mitochondrial; Complex I-18 kDa; CI-18 kDa; Complex I-AQDQ; CI-AQDQ; NADH-ubiquinone oxidoreductase 18 kDa subunit
Clone: K06372_10H6
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 93%, Pig - 95%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: QLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: NDUFS4
Panel Description: Neurodegenerative Diseases Marker
Host or Source: Mouse
Protein Name: NADH:ubiquinone oxidoreductase subunit S4
IHC description: Succeed
IP description: Fail (Mouse Brain)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant NDUFS4 Antibody?

The catalog number for Recombinant NDUFS4 Antibody is RN-037.

What sizes are available for Recombinant NDUFS4 Antibody?

Recombinant NDUFS4 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant NDUFS4 Antibody come in?

Recombinant NDUFS4 Antibody is available in 3 different pack sizes.

Is Recombinant NDUFS4 Antibody in stock?

Recombinant NDUFS4 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

All Products