Recombinant ARAF Antibody

Catalog number RN-005-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-005-01

Size / count 50 μL

Specifications

Catalog number: RN-005-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Serine/threonine-protein kinase A-Raf, Proto-oncogene A-Raf, Proto-oncogene A-Raf-1, Proto-oncogene Pks
Gene Name: ARAF
Gene ID: 369
UniProt: P10398
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ARAF
Target: PP-4370
Partner Proteins: Serine/threonine-protein kinase A-Raf; Proto-oncogene A-Raf; Proto-oncogene A-Raf-1; Proto-oncogene Pks
Clone: K40035_13B11
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 87%, Pig - 91%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Yes
IHC Dilution: 1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ARAF1; PKS; PKS2
Target Alternative Name: ARAF
Host or Source: Mouse
Protein Name: A-Raf proto-oncogene, serine/threonine kinase
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ARAF Antibody?

The catalog number for Recombinant ARAF Antibody is RN-005.

What sizes are available for Recombinant ARAF Antibody?

Recombinant ARAF Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ARAF Antibody come in?

Recombinant ARAF Antibody is available in 3 different pack sizes.

Is Recombinant ARAF Antibody in stock?

Recombinant ARAF Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

All Products