Recombinant TOP1 Antibody

Catalog number RN-001-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-001-01

Size / count 50 μL

Specifications

Catalog number: RN-001-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: DNA topoisomerase 1, DNA topoisomerase I
Gene Name: TOP1
Gene ID: 7150
UniProt: P11387
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TOP1
Target: PP-4377
Partner Proteins: DNA topoisomerase 1; DNA topoisomerase I
Clone: K94015_6C5
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: TOP1
Panel Description: Autoimmune Disease
Host or Source: Human
Protein Name: DNA topoisomerase I
WB Description: Succeed
IHC description: Fail (Tonsil)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Recombinant TOP1 Antibody?

The catalog number for Recombinant TOP1 Antibody is RN-001.

What sizes are available for Recombinant TOP1 Antibody?

Recombinant TOP1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant TOP1 Antibody come in?

Recombinant TOP1 Antibody is available in 3 different pack sizes.

Is Recombinant TOP1 Antibody in stock?

Recombinant TOP1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

All Products