Recombinant TOP1 Antibody

Catalog number RC-006-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-006-01

Size / count 50 μL

Specifications

Catalog number: RC-006-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: DNA topoisomerase 1, DNA topoisomerase I
Gene Name: TOP1
Gene ID: 7150
UniProt: P11387
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TOP1
Target: PP-4377
Partner Proteins: DNA topoisomerase 1; DNA topoisomerase I
Clone: K94015_12B1
Conjugation: Unconjugated
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: TOP1
Panel Description: Autoimmune Disease
Host or Source: Human
Protein Name: DNA topoisomerase I
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Recombinant TOP1 Antibody?

The catalog number for Recombinant TOP1 Antibody is RC-006.

What sizes are available for Recombinant TOP1 Antibody?

Recombinant TOP1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant TOP1 Antibody come in?

Recombinant TOP1 Antibody is available in 3 different pack sizes.

Is Recombinant TOP1 Antibody in stock?

Recombinant TOP1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

All Products