Recombinant PCNA Antibody — image 1 of 3

Product details

Recombinant PCNA Antibody

Catalog number RC-001-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-001-01

Size / count 50 μL

Specifications

Catalog number: RC-001-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Proliferating cell nuclear antigen, PCNA, Cyclin
Gene Name: PCNA
Gene ID: 5111
UniProt: P12004
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PCNA
Target: PP-4381
Partner Proteins: Proliferating cell nuclear antigen; PCNA; Cyclin
Clone: K29023_9D5
Conjugation: Unconjugated
Applications: Top_IP/ChIP&Top_WB
Validation: Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
WB Dilution: 1:200
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: PCNA
Panel Description: IHC Pathology, Autoimmune Disease, DNA binding & Chromatin
Host or Source: Human
Protein Name: Proliferating cell nuclear antigen
WB Description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Recombinant PCNA Antibody?

The catalog number for Recombinant PCNA Antibody is RC-001.

What sizes are available for Recombinant PCNA Antibody?

Recombinant PCNA Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PCNA Antibody come in?

Recombinant PCNA Antibody is available in 3 different pack sizes.

Is Recombinant PCNA Antibody in stock?

Recombinant PCNA Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.