Recombinant PCNA Antibody — image 1 of 2

Product details

Recombinant PCNA Antibody

Catalog number RC-002-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-002-01

Size / count 50 μL

Specifications

Catalog number: RC-002-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Proliferating cell nuclear antigen, PCNA, Cyclin
Gene Name: PCNA
Gene ID: 5111
UniProt: P12004
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PCNA
Target: PP-4381
Partner Proteins: Proliferating cell nuclear antigen; PCNA; Cyclin
Clone: K29023_14A4
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: PCNA
Panel Description: IHC Pathology, Autoimmune Disease, DNA binding & Chromatin
Host or Source: Human
Protein Name: Proliferating cell nuclear antigen
WB Description: Fail (MOLT-4, MCF7, K-562, Hep G2)
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Recombinant PCNA Antibody?

The catalog number for Recombinant PCNA Antibody is RC-002.

What sizes are available for Recombinant PCNA Antibody?

Recombinant PCNA Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PCNA Antibody come in?

Recombinant PCNA Antibody is available in 3 different pack sizes.

Is Recombinant PCNA Antibody in stock?

Recombinant PCNA Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

All Products