Recombinant FTCD Antibody — image 1 of 2

Product details

Recombinant FTCD Antibody

Catalog number RN-003-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-003-01

Size / count 50 μL

Specifications

Catalog number: RN-003-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Formimidoyltransferase-cyclodeaminase, Formiminotransferase-cyclodeaminase, FTCD, LCHC1) [Includes: Glutamate formimidoyltransferase, Glutamate formiminotransferase, Glutamate formyltransferase, Formimidoyltetrahydrofolate cyclodeaminase, Formiminotetrahydrofolate cyclodeaminase]
Gene Name: FTCD
Gene ID: 10841
UniProt: O95954
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human FTCD
Target: PP-5739
Partner Proteins: Formimidoyltransferase-cyclodeaminase; Formiminotransferase-cyclodeaminase; FTCD; LCHC1) [Includes: Glutamate formimidoyltransferase; Glutamate formiminotransferase; Glutamate formyltransferase; Formimidoyltetrahydrofolate cyclodeaminase; Formiminotetrahydrofolate cyclodeaminase]
Clone: K92024_4F3
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 88%, Rat - 89%, Pig - 87%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 88%
Recombinant Antibody: Yes
IHC Dilution: 1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: FTCD
Panel Description: Autoimmune Disease
Host or Source: Human
Protein Name: Formimidoyltransferase cyclodeaminase
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Recombinant FTCD Antibody?

The catalog number for Recombinant FTCD Antibody is RN-003.

What sizes are available for Recombinant FTCD Antibody?

Recombinant FTCD Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant FTCD Antibody come in?

Recombinant FTCD Antibody is available in 3 different pack sizes.

Is Recombinant FTCD Antibody in stock?

Recombinant FTCD Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.