NELL1 Antibody (HRP)

Catalog number KH-3428-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3428-01

Size / count 50 μL

Specifications

Catalog number: KH-3428-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein kinase C-binding protein NELL1, NEL-like protein 1, Nel-related protein 1
Gene Name: NELL1
Gene ID: 4745
UniProt: Q92832
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NELL1
Target: PP-1844
Partner Proteins: Protein kinase C-binding protein NELL1; NEL-like protein 1; Nel-related protein 1
Clone: K06310_14D5
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Rat - 94%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: VLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNW
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 96%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: NRP1
Target Alternative Name: NELL1
Host or Source: Mouse
Protein Name: Neural EGFL like 1
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for NELL1 Antibody (HRP)?

The catalog number for NELL1 Antibody (HRP) is KH-3428.

What sizes are available for NELL1 Antibody (HRP)?

NELL1 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does NELL1 Antibody (HRP) come in?

NELL1 Antibody (HRP) is available in 3 different pack sizes.

Is NELL1 Antibody (HRP) in stock?

NELL1 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

All Products