Caspase-8 Antibody

Catalog number KC-3285-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3285-01

Size / count 50 μL

Specifications

Catalog number: KC-3285-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Caspase-8, CASP-8, Apoptotic cysteine protease, Apoptotic protease Mch-5, CAP4, FADD-homologous ICE/ced-3-like protease, FADD-like ICE, FLICE, ICE-like apoptotic protease 5, MORT1-associated ced-3 homolog, MACH) [Cleaved into: Caspase-8 subunit p18, Caspase-8 subunit p10]
Gene Name: CASP8
Gene ID: 841
UniProt: Q14790
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CASP8
Target: P00536PAD
Partner Proteins: Caspase-8; CASP-8; Apoptotic cysteine protease; Apoptotic protease Mch-5; CAP4; FADD-homologous ICE/ced-3-like protease; FADD-like ICE; FLICE; ICE-like apoptotic protease 5; MORT1-associated ced-3 homolog; MACH) [Cleaved into: Caspase-8 subunit p18; Caspase-8 subunit p10]
Clone: K29071_4E7
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 68%, Rat - 68%, Pig - 63%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: TTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 68%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MCH5
Target Alternative Name: Caspase-8
Panel Description: Neurodegenerative Diseases Marker
Host or Source: Mouse
Protein Name: Caspase 8
WB Description: Fail (Jurkat (10uM Etoposide Dispose 6h), Jurkat, Jurkat (25uM Etoposide Dispose 6h), Jurkat (50uM Etoposide Dispose 6h), Jurkat (10ng/ml FasL Dispose 4h), Jurkat (10ng/ml FasL Dispose 6h), Jurkat (10ng/ml FasL Dispose 20h) )
IHC description: Succeed
IP description: Fail (Jurkat (50uM Etoposide Dispose 6h) )
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Caspase-8 Antibody?

The catalog number for Caspase-8 Antibody is KC-3285.

What sizes are available for Caspase-8 Antibody?

Caspase-8 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Caspase-8 Antibody come in?

Caspase-8 Antibody is available in 3 different pack sizes.

Is Caspase-8 Antibody in stock?

Caspase-8 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

All Products