CD6 Antibody (HRP)

Catalog number KH-3345-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3345-01

Size / count 50 μL

Specifications

Catalog number: KH-3345-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: T-cell differentiation antigen CD6, T12, TP120, CD antigen CD6) [Cleaved into: Soluble CD6]
Gene Name: CD6
Gene ID: 923
UniProt: P30203
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CD6
Target Antigen: CD6
Target: PP-1194
Partner Proteins: T-cell differentiation antigen CD6; T12; TP120; CD antigen CD6) [Cleaved into: Soluble CD6]
Clone: K49021_13C3
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 78%, Pig - 74%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: QAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTANPGHCITDPPSLGPQYHPRSNSESSTSSGE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 78%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CD6
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: CD6 molecule
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for CD6 Antibody (HRP)?

The catalog number for CD6 Antibody (HRP) is KH-3345.

What sizes are available for CD6 Antibody (HRP)?

CD6 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CD6 Antibody (HRP) come in?

CD6 Antibody (HRP) is available in 3 different pack sizes.

Is CD6 Antibody (HRP) in stock?

CD6 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

All Products