IL32 Antibody (HRP)

Catalog number KH-3349-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3349-01

Size / count 50 μL

Specifications

Catalog number: KH-3349-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-32, IL-32, Natural killer cells protein 4, Tumor necrosis factor alpha-inducing factor
Gene Name: IL32
Gene ID: 9235
UniProt: P24001
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL32
Target: PP-1680
Partner Proteins: Interleukin-32; IL-32; Natural killer cells protein 4; Tumor necrosis factor alpha-inducing factor
Clone: K52005_3C12
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Purity: ≥85%
Cores: TVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: NK4; TAIF
Target Alternative Name: IL32
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Interleukin 32
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for IL32 Antibody (HRP)?

The catalog number for IL32 Antibody (HRP) is KH-3349.

What sizes are available for IL32 Antibody (HRP)?

IL32 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL32 Antibody (HRP) come in?

IL32 Antibody (HRP) is available in 3 different pack sizes.

Is IL32 Antibody (HRP) in stock?

IL32 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.