IL32 Antibody (HRP)

Catalog number KH-3347-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3347-01

Size / count 50 μL

Specifications

Catalog number: KH-3347-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interleukin-32, IL-32, Natural killer cells protein 4, Tumor necrosis factor alpha-inducing factor
Gene Name: IL32
Gene ID: 9235
UniProt: P24001
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IL32
Target: PP-1680
Partner Proteins: Interleukin-32; IL-32; Natural killer cells protein 4; Tumor necrosis factor alpha-inducing factor
Clone: K52005_7C8
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Purity: ≥85%
Cores: TVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: NK4; TAIF
Target Alternative Name: IL32
Panel Description: Cytokines
Host or Source: Mouse
Protein Name: Interleukin 32
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for IL32 Antibody (HRP)?

The catalog number for IL32 Antibody (HRP) is KH-3347.

What sizes are available for IL32 Antibody (HRP)?

IL32 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL32 Antibody (HRP) come in?

IL32 Antibody (HRP) is available in 3 different pack sizes.

Is IL32 Antibody (HRP) in stock?

IL32 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.