LILRB4 Antibody (HRP)

Catalog number KH-3344-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KH-3344-01

Size / count 50 μL

Specifications

Catalog number: KH-3344-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Leukocyte immunoglobulin-like receptor subfamily B member 4, B4, CD85 antigen-like family member K, Immunoglobulin-like transcript 3, ILT-3, Leukocyte immunoglobulin-like receptor 5, LIR-5, Monocyte inhibitory receptor HM18, CD antigen CD85k
Gene Name: LILRB4
Gene ID: 11006
UniProt: Q8NHJ6
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human LILRB4
Target Antigen: CD85k
Target: PP-915
Partner Proteins: Leukocyte immunoglobulin-like receptor subfamily B member 4; B4; CD85 antigen-like family member K; Immunoglobulin-like transcript 3; ILT-3; Leukocyte immunoglobulin-like receptor 5; LIR-5; Monocyte inhibitory receptor HM18; CD antigen CD85k
Clone: K56035_8G10
Conjugation: Conjugated with peroxidase
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 50%, Rat - 53%, Pig - 56%, Cynomolgus monkey - 85%
Purity: ≥85%
Cores: LAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSPHDEDPQAVTYAKVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSFTLRQKATEPPPSQEGASPAEPS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 50%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS), carrier-free, with optional 0.01% thimerosal
Antibody Type: Monoclonal
Gene Name Synonym: ILT3; LIR5
Target Alternative Name: LILRB4
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Leukocyte immunoglobulin like receptor B4
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for LILRB4 Antibody (HRP)?

The catalog number for LILRB4 Antibody (HRP) is KH-3344.

What sizes are available for LILRB4 Antibody (HRP)?

LILRB4 Antibody (HRP) is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does LILRB4 Antibody (HRP) come in?

LILRB4 Antibody (HRP) is available in 3 different pack sizes.

Is LILRB4 Antibody (HRP) in stock?

LILRB4 Antibody (HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

All Products