Recombinant WDR25 Antibody

Catalog number RN-044-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-044-01

Size / count 50 μL

Specifications

Catalog number: RN-044-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: WD repeat-containing protein 25
Gene Name: WDR25
Gene ID: 79446
UniProt: Q64LD2
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human WDR25
Target: PP-9491
Partner Proteins: WD repeat-containing protein 25
Clone: K9N019_16F2
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 57%, Pig - 58%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: EAETEHAGSFNATGQQKDTSGVARPPGQDFASGTLDVPKAGAQPTKHGSCEDPGGYRLPLAQLGRSDWGSCPSQRLQWPGKEPQVTFPIKEPSCSSLWTSHVPASHMPLAAARFKQVKLSRNFPKSSFHAQSESETVGKNGSSFQKKKCEDCVVPYTPRRLRQRQALSTETGKGKDVEPQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 57%
Recombinant Antibody: Yes
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C14orf67
Target Alternative Name: WDR25
Host or Source: Mouse
Protein Name: WD repeat domain 25
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant WDR25 Antibody?

The catalog number for Recombinant WDR25 Antibody is RN-044.

What sizes are available for Recombinant WDR25 Antibody?

Recombinant WDR25 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant WDR25 Antibody come in?

Recombinant WDR25 Antibody is available in 3 different pack sizes.

Is Recombinant WDR25 Antibody in stock?

Recombinant WDR25 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

All Products