Recombinant RNF115 Antibody

Catalog number RN-048-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-048-01

Size / count 50 μL

Specifications

Catalog number: RN-048-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: E3 ubiquitin-protein ligase RNF115, RING finger protein 115, RING-type E3 ubiquitin transferase RNF115, Rab7-interacting RING finger protein, Rabring 7, Zinc finger protein 364
Gene Name: RNF115
Gene ID: 27246
UniProt: Q9Y4L5
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human RNF115
Target: PP-8433
Partner Proteins: E3 ubiquitin-protein ligase RNF115; RING finger protein 115; RING-type E3 ubiquitin transferase RNF115; Rab7-interacting RING finger protein; Rabring 7; Zinc finger protein 364
Clone: K8U026_19C10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 36%, Pig - 88%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: QVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQSQSTEASASN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Yes
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ZNF364
Target Alternative Name: RNF115
Panel Description: E3 Ligase, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Ring finger protein 115
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant RNF115 Antibody?

The catalog number for Recombinant RNF115 Antibody is RN-048.

What sizes are available for Recombinant RNF115 Antibody?

Recombinant RNF115 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant RNF115 Antibody come in?

Recombinant RNF115 Antibody is available in 3 different pack sizes.

Is Recombinant RNF115 Antibody in stock?

Recombinant RNF115 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

All Products