Recombinant SUMF2 Antibody — image 1 of 3

Product details

Recombinant SUMF2 Antibody

Catalog number RN-050-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-050-01

Size / count 50 μL

Specifications

Catalog number: RN-050-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Inactive C-alpha-formylglycine-generating enzyme 2, Paralog of formylglycine-generating enzyme, pFGE, Sulfatase-modifying factor 2
Gene Name: SUMF2
Gene ID: 25870
UniProt: Q8NBJ7
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SUMF2
Target: P02366PAD
Partner Proteins: Inactive C-alpha-formylglycine-generating enzyme 2; Paralog of formylglycine-generating enzyme; pFGE; Sulfatase-modifying factor 2
Clone: K94061_20B7
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP&Top_WB
Validation: Top_IHC&Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 77%, Pig - 86%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: VQLQGGRFLMGTNSPDSRDGDGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAFWRQPAGPGSGIRERL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 77%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: SUMF2
Host or Source: Mouse
Protein Name: Sulfatase modifying factor 2
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant SUMF2 Antibody?

The catalog number for Recombinant SUMF2 Antibody is RN-050.

What sizes are available for Recombinant SUMF2 Antibody?

Recombinant SUMF2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SUMF2 Antibody come in?

Recombinant SUMF2 Antibody is available in 3 different pack sizes.

Is Recombinant SUMF2 Antibody in stock?

Recombinant SUMF2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

All Products