Recombinant VAX1 Antibody

Catalog number RN-045-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-045-01

Size / count 50 μL

Specifications

Catalog number: RN-045-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ventral anterior homeobox 1
Gene Name: VAX1
Gene ID: 11023
UniProt: Q5SQQ9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human VAX1
Target: PP-10105
Partner Proteins: Ventral anterior homeobox 1
Clone: K29066_16C2
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: RCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: VAX1
Panel Description: DNA binding & Chromatin, Transcription Factors
Host or Source: Mouse
Protein Name: Ventral anterior homeobox 1
IHC description: Fail (Endometrium Smooth Muscle)
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant VAX1 Antibody?

The catalog number for Recombinant VAX1 Antibody is RN-045.

What sizes are available for Recombinant VAX1 Antibody?

Recombinant VAX1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant VAX1 Antibody come in?

Recombinant VAX1 Antibody is available in 3 different pack sizes.

Is Recombinant VAX1 Antibody in stock?

Recombinant VAX1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.