Recombinant ADAM22 Antibody — image 1 of 3

Product details

Recombinant ADAM22 Antibody

Catalog number RN-052-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-052-01

Size / count 50 μL

Specifications

Catalog number: RN-052-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Disintegrin and metalloproteinase domain-containing protein 22, ADAM 22, Metalloproteinase-disintegrin ADAM22-3, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2
Gene Name: ADAM22
Gene ID: 53616
UniProt: Q9P0K1
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human ADAM22
Target: PP-1373
Partner Proteins: Disintegrin and metalloproteinase domain-containing protein 22; ADAM 22; Metalloproteinase-disintegrin ADAM22-3; Metalloproteinase-like; disintegrin-like; and cysteine-rich protein 2
Clone: K40080_20C9
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: QGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MDC2
Target Alternative Name: ADAM22
Host or Source: Mouse
Protein Name: ADAM metallopeptidase domain 22
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ADAM22 Antibody?

The catalog number for Recombinant ADAM22 Antibody is RN-052.

What sizes are available for Recombinant ADAM22 Antibody?

Recombinant ADAM22 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ADAM22 Antibody come in?

Recombinant ADAM22 Antibody is available in 3 different pack sizes.

Is Recombinant ADAM22 Antibody in stock?

Recombinant ADAM22 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

All Products