Product details

Recombinant ASL Antibody

Catalog number RN-059-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-059-01

Size / count 50 μL

Specifications

Catalog number: RN-059-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Argininosuccinate lyase, ASAL, Arginosuccinase
Gene Name: ASL
Gene ID: 435
UniProt: P04424
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ASL
Target: PP-4724
Partner Proteins: Argininosuccinate lyase; ASAL; Arginosuccinase
Clone: KBL001_19F1
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP&Top_WB
Validation: Top_IHC&Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 90%, Pig - 95%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ASL
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Argininosuccinate lyase
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ASL Antibody?

The catalog number for Recombinant ASL Antibody is RN-059.

What sizes are available for Recombinant ASL Antibody?

Recombinant ASL Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ASL Antibody come in?

Recombinant ASL Antibody is available in 3 different pack sizes.

Is Recombinant ASL Antibody in stock?

Recombinant ASL Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

All Products