Recombinant SERPINB1 Antibody

Catalog number RN-076-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-076-01

Size / count 50 μL

Specifications

Catalog number: RN-076-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Leukocyte elastase inhibitor, LEI, Monocyte/neutrophil elastase inhibitor, EI, M/NEI, Peptidase inhibitor 2, PI-2, Serpin B1
Gene Name: SERPINB1
Gene ID: 1992
UniProt: P30740
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SERPINB1
Target: PP-243
Partner Proteins: Leukocyte elastase inhibitor; LEI; Monocyte/neutrophil elastase inhibitor; EI; M/NEI; Peptidase inhibitor 2; PI-2; Serpin B1
Clone: K1H017_19G1
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 85%, Pig - 81%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: DLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 85%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ELANH2; MNEI; PI2
Target Alternative Name: SERPINB1
Host or Source: Mouse
Protein Name: Serpin family B member 1
IHC description: Succeed
IP description: Fail (K-562)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant SERPINB1 Antibody?

The catalog number for Recombinant SERPINB1 Antibody is RN-076.

What sizes are available for Recombinant SERPINB1 Antibody?

Recombinant SERPINB1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SERPINB1 Antibody come in?

Recombinant SERPINB1 Antibody is available in 3 different pack sizes.

Is Recombinant SERPINB1 Antibody in stock?

Recombinant SERPINB1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.