Recombinant NECAB2 Antibody

Catalog number RN-064-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-064-01

Size / count 50 μL

Specifications

Catalog number: RN-064-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: N-terminal EF-hand calcium-binding protein 2, EF-hand calcium-binding protein 2, Neuronal calcium-binding protein 2, Synaptotagmin-interacting protein 2, Stip-2
Gene Name: NECAB2
Gene ID: 54550
UniProt: Q7Z6G3
Antigen Species: Human
Reactivity: Human, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant human NECAB2
Target: PP-7897
Partner Proteins: N-terminal EF-hand calcium-binding protein 2; EF-hand calcium-binding protein 2; Neuronal calcium-binding protein 2; Synaptotagmin-interacting protein 2; Stip-2
Clone: K8U020_6F7
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: GTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQLRQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: EFCBP2
Target Alternative Name: NECAB2
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: N-terminal EF-hand calcium binding protein 2
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant NECAB2 Antibody?

The catalog number for Recombinant NECAB2 Antibody is RN-064.

What sizes are available for Recombinant NECAB2 Antibody?

Recombinant NECAB2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant NECAB2 Antibody come in?

Recombinant NECAB2 Antibody is available in 3 different pack sizes.

Is Recombinant NECAB2 Antibody in stock?

Recombinant NECAB2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

All Products