Recombinant HRPT2 Antibody

Catalog number RN-067-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-067-01

Size / count 50 μL

Specifications

Catalog number: RN-067-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Parafibromin, Cell division cycle protein 73 homolog, Hyperparathyroidism 2 protein
Gene Name: CDC73
Gene ID: 79577
UniProt: Q6P1J9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CDC73
Target: PP-11053
Partner Proteins: Parafibromin; Cell division cycle protein 73 homolog; Hyperparathyroidism 2 protein
Clone: K9N029_6F8
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: KTQTPAAQPVPRPVSQARPPPNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C1orf28; HRPT2
Target Alternative Name: HRPT2
Host or Source: Mouse
Protein Name: Cell division cycle 73
WB Description: Succeed
IP description: Fail (HeLa)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant HRPT2 Antibody?

The catalog number for Recombinant HRPT2 Antibody is RN-067.

What sizes are available for Recombinant HRPT2 Antibody?

Recombinant HRPT2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant HRPT2 Antibody come in?

Recombinant HRPT2 Antibody is available in 3 different pack sizes.

Is Recombinant HRPT2 Antibody in stock?

Recombinant HRPT2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

All Products