Recombinant ATG3 Antibody — image 1 of 2

Product details

Recombinant ATG3 Antibody

Catalog number RN-056-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-056-01

Size / count 50 μL

Specifications

Catalog number: RN-056-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ubiquitin-like-conjugating enzyme ATG3, Autophagy-related protein 3, APG3-like, hApg3, Protein PC3-96
Gene Name: ATG3
Gene ID: 64422
UniProt: Q9NT62
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ATG3
Target: PP-10579
Partner Proteins: Ubiquitin-like-conjugating enzyme ATG3; Autophagy-related protein 3; APG3-like; hApg3; Protein PC3-96
Clone: K8U033_11C5
Conjugation: Unconjugated
Applications: Top_IHC&WB
Validation: Top_IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 98%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: KALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
IHC Dilution: 1:250~1:500
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: APG3; APG3L
Target Alternative Name: ATG3
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: Autophagy related 3
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ATG3 Antibody?

The catalog number for Recombinant ATG3 Antibody is RN-056.

What sizes are available for Recombinant ATG3 Antibody?

Recombinant ATG3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ATG3 Antibody come in?

Recombinant ATG3 Antibody is available in 3 different pack sizes.

Is Recombinant ATG3 Antibody in stock?

Recombinant ATG3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products