Recombinant CHML Antibody

Catalog number RN-063-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-063-01

Size / count 50 μL

Specifications

Catalog number: RN-063-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Rab proteins geranylgeranyltransferase component A 2, Choroideremia-like protein, Rab escort protein 2, REP-2
Gene Name: CHML
Gene ID: 1122
UniProt: P26374
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CHML
Target: PP-7194
Partner Proteins: Rab proteins geranylgeranyltransferase component A 2; Choroideremia-like protein; Rab escort protein 2; REP-2
Clone: K92072_16C11
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 70%, Rat - 56%, Pig - 63%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: VVIIGTGLPESILAAACSRSGQRVLHIDSRSYYGGNWASFSFSGLLSWLKEYQQNNDIGEESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITYSQIVKEGRRFN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 70%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: REP2
Target Alternative Name: CHML
Host or Source: Mouse
Protein Name: CHM like Rab escort protein
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant CHML Antibody?

The catalog number for Recombinant CHML Antibody is RN-063.

What sizes are available for Recombinant CHML Antibody?

Recombinant CHML Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CHML Antibody come in?

Recombinant CHML Antibody is available in 3 different pack sizes.

Is Recombinant CHML Antibody in stock?

Recombinant CHML Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

All Products