Product details

Recombinant BID Antibody

Catalog number RN-070-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-070-01

Size / count 50 μL

Specifications

Catalog number: RN-070-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: BH3-interacting domain death agonist, p22 BID, BID) [Cleaved into: BH3-interacting domain death agonist p15, p15 BID, BH3-interacting domain death agonist p13, p13 BID, BH3-interacting domain death agonist p11, p11 BID]
Gene Name: BID
Gene ID: 637
UniProt: P55957
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human BID
Target: PP-1286
Partner Proteins: BH3-interacting domain death agonist; p22 BID; BID) [Cleaved into: BH3-interacting domain death agonist p15; p15 BID; BH3-interacting domain death agonist p13; p13 BID; BH3-interacting domain death agonist p11; p11 BID]
Clone: K40084_20C7
Conjugation: Unconjugated
Applications: Top_IP/ChIP&Top_WB
Validation: Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 59%, Rat - 57%, Pig - 60%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 59%
Recombinant Antibody: Yes
WB Dilution: 1:2000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: BID
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: BH3 interacting domain death agonist
WB Description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant BID Antibody?

The catalog number for Recombinant BID Antibody is RN-070.

What sizes are available for Recombinant BID Antibody?

Recombinant BID Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant BID Antibody come in?

Recombinant BID Antibody is available in 3 different pack sizes.

Is Recombinant BID Antibody in stock?

Recombinant BID Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

All Products