S100 alpha9 Antibody

Catalog number KC-7119-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7119-01

Size / count 50 μL

Specifications

Catalog number: KC-7119-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein S100-A9, Calgranulin-B, Calprotectin L1H subunit, Leukocyte L1 complex heavy chain, Migration inhibitory factor-related protein 14, MRP-14, p14, S100 calcium-binding protein A9
Gene Name: S100A9
Gene ID: 6280
UniProt: P06702
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human S100A9
Target: PP-1600
Partner Proteins: Protein S100-A9; Calgranulin-B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9
Clone: K1L011_1G9
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 60%, Rat - 64%, Pig - 66%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 60%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CAGB; CFAG; MRP14
Target Alternative Name: S100 alpha9
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: S100 calcium binding protein A9
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for S100 alpha9 Antibody?

The catalog number for S100 alpha9 Antibody is KC-7119.

What sizes are available for S100 alpha9 Antibody?

S100 alpha9 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does S100 alpha9 Antibody come in?

S100 alpha9 Antibody is available in 3 different pack sizes.

Is S100 alpha9 Antibody in stock?

S100 alpha9 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

All Products