Lysosome Membrane Protein 2 Antibody

Catalog number KC-3926-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3926-01

Size / count 50 μL

Specifications

Catalog number: KC-3926-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Lysosome membrane protein 2, 85 kDa lysosomal membrane sialoglycoprotein, LGP85, CD36 antigen-like 2, Lysosome membrane protein II, LIMP II, Scavenger receptor class B member 2, CD antigen CD36
Gene Name: SCARB2
Gene ID: 950
UniProt: Q14108
Antigen Species: Human
Reactivity: Human, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant human SCARB2
Target Antigen: CD36
Target: PP-461
Partner Proteins: Lysosome membrane protein 2; 85 kDa lysosomal membrane sialoglycoprotein; LGP85; CD36 antigen-like 2; Lysosome membrane protein II; LIMP II; Scavenger receptor class B member 2; CD antigen CD36
Clone: K92051_1C7
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 83%, Pig - 85%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: NPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CD36L2; LIMP2; LIMPII
Target Alternative Name: Lysosome Membrane Protein 2
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Scavenger receptor class B member 2
WB Description: Fail (Rat Heart, Mouse Liver)
IHC description: Fail (Liver)
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2b

Frequently Asked Questions

What is the catalog number for Lysosome Membrane Protein 2 Antibody?

The catalog number for Lysosome Membrane Protein 2 Antibody is KC-3926.

What sizes are available for Lysosome Membrane Protein 2 Antibody?

Lysosome Membrane Protein 2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Lysosome Membrane Protein 2 Antibody come in?

Lysosome Membrane Protein 2 Antibody is available in 3 different pack sizes.

Is Lysosome Membrane Protein 2 Antibody in stock?

Lysosome Membrane Protein 2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.