Prostate Specific Antigen Antibody

Catalog number KC-4391-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-4391-01

Size / count 50 μL

Specifications

Catalog number: KC-4391-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Prostate-specific antigen, PSA, Gamma-seminoprotein, Seminin, Kallikrein-3, P-30 antigen, Semenogelase
Gene Name: KLK3
Gene ID: 354
UniProt: P07288
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Purified recombinant fragment of human KLK3 expressed in E. Coli.
Partner Proteins: Prostate-specific antigen; PSA; Gamma-seminoprotein; Seminin; Kallikrein-3; P-30 antigen; Semenogelase
Clone: K01_1J82
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: RFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
WB Dilution: 1:500~1:1000
Formulation: Liquid in PBS containing 50% glycerol,0.5% BSA and 0.02% sodium azide, pH 7.3
Antibody Type: Monoclonal
Gene Name Synonym: APS
Target Alternative Name: Prostate Specific Antigen
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Kallikrein related peptidase 3
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Prostate Specific Antigen Antibody?

The catalog number for Prostate Specific Antigen Antibody is KC-4391.

What sizes are available for Prostate Specific Antigen Antibody?

Prostate Specific Antigen Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Prostate Specific Antigen Antibody come in?

Prostate Specific Antigen Antibody is available in 3 different pack sizes.

Is Prostate Specific Antigen Antibody in stock?

Prostate Specific Antigen Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.