Recombinant ATG13 Antibody — image 1 of 2

Product details

Recombinant ATG13 Antibody

Catalog number RC-4036-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4036-01

Size / count 50 μL

Specifications

Catalog number: RC-4036-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Autophagy-related protein 13
Gene Name: ATG13
Gene ID: 9776
UniProt: O75143
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human KIAA0652
Partner Proteins: Autophagy-related protein 13
Clone: K01_1K67
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Pig - 96%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: QTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: KIAA0652
Target Alternative Name: ATG13
Panel Description: Ferroptosis
Host or Source: Rabbit
Protein Name: Autophagy related 13
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant ATG13 Antibody?

The catalog number for Recombinant ATG13 Antibody is RC-4036.

What sizes are available for Recombinant ATG13 Antibody?

Recombinant ATG13 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ATG13 Antibody come in?

Recombinant ATG13 Antibody is available in 3 different pack sizes.

Is Recombinant ATG13 Antibody in stock?

Recombinant ATG13 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

All Products