Recombinant PAX6 Antibody

Catalog number RC-4332-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4332-01

Size / count 50 μL

Specifications

Catalog number: RC-4332-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Paired box protein Pax-6, Aniridia type II protein, Oculorhombin
Gene Name: PAX6
Gene ID: 5080
UniProt: P26367
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human PAX6
Partner Proteins: Paired box protein Pax-6; Aniridia type II protein; Oculorhombin
Clone: K01_1L16
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: ISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIPISSSFSTSVYQPIPQPTTPVSSFT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: AN2
Target Alternative Name: PAX6
Panel Description: Neuroscience Biomarkers, DNA binding & Chromatin, Transcription Factors
Host or Source: Rabbit
Protein Name: Paired box 6
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant PAX6 Antibody?

The catalog number for Recombinant PAX6 Antibody is RC-4332.

What sizes are available for Recombinant PAX6 Antibody?

Recombinant PAX6 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PAX6 Antibody come in?

Recombinant PAX6 Antibody is available in 3 different pack sizes.

Is Recombinant PAX6 Antibody in stock?

Recombinant PAX6 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.