Recombinant MLLT10 Antibody

Catalog number RC-4505-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4505-01

Size / count 50 μL

Specifications

Catalog number: RC-4505-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein AF-10, ALL1-fused gene from chromosome 10 protein
Gene Name: MLLT10
Gene ID: 8028
UniProt: P55197
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human AF10
Partner Proteins: Protein AF-10; ALL1-fused gene from chromosome 10 protein
Clone: K01_1M47
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Pig - 93%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: NPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQSTSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAINGIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPEQHQAFLYQLMQHHHQQHHQPELQQLQIPGPTQIPINNLLAGTQAPPLHTATTNPFLTIHGDNAS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: AF10
Target Alternative Name: MLLT10
Host or Source: Rabbit
Protein Name: MLLT10 histone lysine methyltransferase DOT1L cofactor
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant MLLT10 Antibody?

The catalog number for Recombinant MLLT10 Antibody is RC-4505.

What sizes are available for Recombinant MLLT10 Antibody?

Recombinant MLLT10 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant MLLT10 Antibody come in?

Recombinant MLLT10 Antibody is available in 3 different pack sizes.

Is Recombinant MLLT10 Antibody in stock?

Recombinant MLLT10 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

All Products