Recombinant ATP6V0D1 Antibody — image 1 of 2

Product details

Recombinant ATP6V0D1 Antibody

Catalog number RC-4469-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4469-01

Size / count 50 μL

Specifications

Catalog number: RC-4469-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: V-type proton ATPase subunit d 1, V-ATPase subunit d 1, 32 kDa accessory protein, V-ATPase 40 kDa accessory protein, V-ATPase AC39 subunit, p39, Vacuolar proton pump subunit d 1
Gene Name: ATP6V0D1
Gene ID: 9114
UniProt: P61421
Antigen Species: Human
Reactivity: Human, Rat, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human ATP6V0D1
Partner Proteins: V-type proton ATPase subunit d 1; V-ATPase subunit d 1; 32 kDa accessory protein; V-ATPase 40 kDa accessory protein; V-ATPase AC39 subunit; p39; Vacuolar proton pump subunit d 1
Clone: K01_1N28
Conjugation: Unconjugated
Applications: IHC&WB&ICC/IF
Validation: IHC&WB&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 67%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: ATP6D; VPATPD
Target Alternative Name: ATP6V0D1
Host or Source: Rabbit
Protein Name: ATPase H+ transporting V0 subunit d1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant ATP6V0D1 Antibody?

The catalog number for Recombinant ATP6V0D1 Antibody is RC-4469.

What sizes are available for Recombinant ATP6V0D1 Antibody?

Recombinant ATP6V0D1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ATP6V0D1 Antibody come in?

Recombinant ATP6V0D1 Antibody is available in 3 different pack sizes.

Is Recombinant ATP6V0D1 Antibody in stock?

Recombinant ATP6V0D1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.