Recombinant BORA Antibody — image 1 of 2

Product details

Recombinant BORA Antibody

Catalog number RC-4430-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4430-01

Size / count 50 μL

Specifications

Catalog number: RC-4430-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein aurora borealis, HsBora
Gene Name: BORA
Gene ID: 79866
UniProt: Q6PGQ7
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human Bora
Partner Proteins: Protein aurora borealis; HsBora
Clone: K01_1N63
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 85%, Pig - 92%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: MGDVKESKMQITPETPGRIPVLNPFESPSDYSNLHEQTLASPSVFKSTKLPTPGKFRWSIDQLAVINPVEIDPEDIHRQALYLSHSRIDKDVEDKRQKAIEEFFTKDVIVPSPWTDHEGKQLSQCHSSKCTNINSDSPVGKKLTIHSEKSDAACQTLLSLPVDFNLENILGDYFRADEFADQSPGNLSS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: C13orf34
Target Alternative Name: BORA
Host or Source: Rabbit
Protein Name: BORA aurora kinase A activator
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant BORA Antibody?

The catalog number for Recombinant BORA Antibody is RC-4430.

What sizes are available for Recombinant BORA Antibody?

Recombinant BORA Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant BORA Antibody come in?

Recombinant BORA Antibody is available in 3 different pack sizes.

Is Recombinant BORA Antibody in stock?

Recombinant BORA Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

All Products