Recombinant CD3E Antibody — image 1 of 2

Product details

Recombinant CD3E Antibody

Catalog number RC-4262-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4262-01

Size / count 50 μL

Specifications

Catalog number: RC-4262-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: T-cell surface glycoprotein CD3 epsilon chain, T-cell surface antigen T3/Leu-4 epsilon chain, CD antigen CD3e
Gene Name: CD3E
Gene ID: 916
UniProt: P07766
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: A synthetic peptide of human CD3 epsilon
Target Antigen: CD3e
Partner Proteins: T-cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; CD antigen CD3e
Clone: K01_1P16
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Purity: ≥85%
Cores: YWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: T3E
Target Alternative Name: CD3E
Panel Description: CD Antigen, Neuroscience Biomarkers
Host or Source: Rabbit
Protein Name: CD3 epsilon subunit of T-cell receptor complex
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant CD3E Antibody?

The catalog number for Recombinant CD3E Antibody is RC-4262.

What sizes are available for Recombinant CD3E Antibody?

Recombinant CD3E Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CD3E Antibody come in?

Recombinant CD3E Antibody is available in 3 different pack sizes.

Is Recombinant CD3E Antibody in stock?

Recombinant CD3E Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

All Products