Recombinant CLDN3 Antibody

Catalog number RC-5109-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5109-01

Size / count 50 μL

Specifications

Catalog number: RC-5109-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Claudin-3, Clostridium perfringens enterotoxin receptor 2, CPE-R 2, CPE-receptor 2, Rat ventral prostate.1 protein homolog, hRVP1
Gene Name: CLDN3
Gene ID: 1365
UniProt: O15551
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: A synthetic peptide of human Claudin 3
Partner Proteins: Claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE-R 2; CPE-receptor 2; Rat ventral prostate.1 protein homolog; hRVP1
Clone: K01_1P61
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: QLLGGALLCCSCPPREKKYTATKVVYSAPR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: C7orf1; CPETR2
Target Alternative Name: CLDN3
Host or Source: Rabbit
Protein Name: Claudin 3
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant CLDN3 Antibody?

The catalog number for Recombinant CLDN3 Antibody is RC-5109.

What sizes are available for Recombinant CLDN3 Antibody?

Recombinant CLDN3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CLDN3 Antibody come in?

Recombinant CLDN3 Antibody is available in 3 different pack sizes.

Is Recombinant CLDN3 Antibody in stock?

Recombinant CLDN3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

All Products