Recombinant Cytochrome P450 1B1 Antibody — image 1 of 2

Product details

Recombinant Cytochrome P450 1B1 Antibody

Catalog number RC-5129-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5129-01

Size / count 50 μL

Specifications

Catalog number: RC-5129-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cytochrome P450 1B1, CYPIB1, Hydroperoxy icosatetraenoate dehydratase
Gene Name: CYP1B1
Gene ID: 1545
UniProt: Q16678
Antigen Species: Human
Reactivity: Human, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human CYP1B1
Partner Proteins: Cytochrome P450 1B1; CYPIB1; Hydroperoxy icosatetraenoate dehydratase
Clone: K01_1Q09
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 78%, Rat - 79%, Pig - 84%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: NHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETCQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 78%
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Cytochrome P450 1B1
Panel Description: Ferroptosis
Host or Source: Rabbit
Protein Name: Cytochrome P450 family 1 subfamily B member 1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant Cytochrome P450 1B1 Antibody?

The catalog number for Recombinant Cytochrome P450 1B1 Antibody is RC-5129.

What sizes are available for Recombinant Cytochrome P450 1B1 Antibody?

Recombinant Cytochrome P450 1B1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant Cytochrome P450 1B1 Antibody come in?

Recombinant Cytochrome P450 1B1 Antibody is available in 3 different pack sizes.

Is Recombinant Cytochrome P450 1B1 Antibody in stock?

Recombinant Cytochrome P450 1B1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

All Products