Recombinant FAM98B Antibody — image 1 of 3

Product details

Recombinant FAM98B Antibody

Catalog number RC-5318-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5318-01

Size / count 50 μL

Specifications

Catalog number: RC-5318-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein FAM98B
Gene Name: FAM98B
Gene ID: 283742
UniProt: Q52LJ0
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human FAM98B
Partner Proteins: Protein FAM98B
Clone: K01_1R05
Conjugation: Unconjugated
Applications: IHC&WB&ICC/IF
Validation: IHC&WB&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 49%, Pig - 93%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: QNKKHKNSQLDKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRMLMKRLDVTVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: FAM98B
Host or Source: Rabbit
Protein Name: Family with sequence similarity 98 member B
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant FAM98B Antibody?

The catalog number for Recombinant FAM98B Antibody is RC-5318.

What sizes are available for Recombinant FAM98B Antibody?

Recombinant FAM98B Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant FAM98B Antibody come in?

Recombinant FAM98B Antibody is available in 3 different pack sizes.

Is Recombinant FAM98B Antibody in stock?

Recombinant FAM98B Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

All Products