Recombinant GCET2 Antibody

Catalog number RC-4956-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4956-01

Size / count 50 μL

Specifications

Catalog number: RC-4956-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Germinal center-associated signaling and motility protein, Germinal center B-cell-expressed transcript 2 protein, Germinal center-associated lymphoma protein, hGAL
Gene Name: GCSAM
Gene ID: 257144
UniProt: Q8N6F7
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human GCET2
Partner Proteins: Germinal center-associated signaling and motility protein; Germinal center B-cell-expressed transcript 2 protein; Germinal center-associated lymphoma protein; hGAL
Clone: K01_1R55
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 55%, Pig - 67%, Cynomolgus monkey - 92%
Purity: ≥85%
Cores: MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 55%
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: GAL; GCET2
Target Alternative Name: GCET2
Host or Source: Rabbit
Protein Name: Germinal center associated signaling and motility
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant GCET2 Antibody?

The catalog number for Recombinant GCET2 Antibody is RC-4956.

What sizes are available for Recombinant GCET2 Antibody?

Recombinant GCET2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant GCET2 Antibody come in?

Recombinant GCET2 Antibody is available in 3 different pack sizes.

Is Recombinant GCET2 Antibody in stock?

Recombinant GCET2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.