Recombinant HSPA2 Antibody — image 1 of 3

Product details

Recombinant HSPA2 Antibody

Catalog number RC-4673-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4673-01

Size / count 50 μL

Specifications

Catalog number: RC-4673-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Heat shock-related 70 kDa protein 2, Heat shock 70 kDa protein 2
Gene Name: HSPA2
Gene ID: 3306
UniProt: P54652
Antigen Species: Human
Reactivity: Mouse, Human, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human HSPA2
Partner Proteins: Heat shock-related 70 kDa protein 2; Heat shock 70 kDa protein 2
Clone: K01_1S61
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 97%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: ILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Yes
IHC Dilution: 1:8000
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: HSPA2
Panel Description: Ferroptosis
Host or Source: Rabbit
Protein Name: Heat shock protein family A (Hsp70) member 2
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant HSPA2 Antibody?

The catalog number for Recombinant HSPA2 Antibody is RC-4673.

What sizes are available for Recombinant HSPA2 Antibody?

Recombinant HSPA2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant HSPA2 Antibody come in?

Recombinant HSPA2 Antibody is available in 3 different pack sizes.

Is Recombinant HSPA2 Antibody in stock?

Recombinant HSPA2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

All Products