Recombinant L1CAM Antibody

Catalog number RC-4905-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4905-01

Size / count 50 μL

Specifications

Catalog number: RC-4905-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Neural cell adhesion molecule L1, N-CAM-L1, NCAM-L1, CD antigen CD171
Gene Name: L1CAM
Gene ID: 3897
UniProt: P32004
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human L1CAM
Target Antigen: CD171
Partner Proteins: Neural cell adhesion molecule L1; N-CAM-L1; NCAM-L1; CD antigen CD171
Clone: K01_1T32
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: HPEALHLECQSNTSLLLRWQPPLSHNGVLTGYVLSYHPLDEGGKGQLSFNLRDPELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: CAML1; MIC5
Target Alternative Name: L1CAM
Panel Description: CD Antigen, Neuroscience Biomarkers
Host or Source: Rabbit
Protein Name: L1 cell adhesion molecule
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant L1CAM Antibody?

The catalog number for Recombinant L1CAM Antibody is RC-4905.

What sizes are available for Recombinant L1CAM Antibody?

Recombinant L1CAM Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant L1CAM Antibody come in?

Recombinant L1CAM Antibody is available in 3 different pack sizes.

Is Recombinant L1CAM Antibody in stock?

Recombinant L1CAM Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

All Products